SCOPe 2.06: Domain d3vhxc1: 3vhx C:13-173

Lineage for d3vhxc1 (3vhx C:13-173)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries)

8. Domain d3vhxc1: 3vhx C:13-173 [217821]
   Other proteins in same PDB: d3vhxa2, d3vhxc2, d3vhxe2, d3vhxg2
   automated match to d1upta_
   complexed with gol, gtp, mg

Details for d3vhxc1

PDB Entry: 3vhx, 2.81 Å

PDB Description: The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex

PDB Compounds: (C:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d3vhxc1:

Sequence; same for both SEQRES and ATOM records:

>d3vhxc1 c.37.1.8 (C:13-173) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
emrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkirp
lwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkp
heiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

Timeline for d3vhxc1:

• d3vhxc1 first appeared in SCOPe 2.03, called d3vhxc_
  
• d3vhxc1 was called d3vhxc_ in SCOPe 2.05
  
• d3vhxc1 appears in SCOPe 2.07
  
• d3vhxc1 appears in the current release, SCOPe 2.08