SCOPe 2.03: Domain d3vgba2: 3vgb A:91-490

Lineage for d3vgba2 (3vgb A:91-490)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
   contains an additional N-terminal domain

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (3 PDB entries)

8. Domain d3vgba2: 3vgb A:91-490 [217814]
   Other proteins in same PDB: d3vgba1, d3vgba3
   automated match to d1eh9a3
   complexed with flc, gol

Details for d3vgba2

PDB Entry: 3vgb, 2.65 Å

PDB Description: Crystal structure of glycosyltrehalose trehalohydrolase (GTHase) from Sulfolobus solfataricus KM1

PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgba2:

Sequence; same for both SEQRES and ATOM records:

>d3vgba2 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekcgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

Timeline for d3vgba2:

• d3vgba2 is new in SCOPe 2.03-stable
  
• d3vgba2 appears in SCOPe 2.04
  
• d3vgba2 appears in the current release, SCOPe 2.08