Lineage for d2fcba1 (2fcb A:6-90)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54288Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 54294Species Human (Homo sapiens), IIb [TaxId:9606] [49198] (1 PDB entry)
  8. 54295Domain d2fcba1: 2fcb A:6-90 [21781]

Details for d2fcba1

PDB Entry: 2fcb (more details), 1.74 Å

PDB Description: human fc gamma receptor iib ectodomain (cd32)

SCOP Domain Sequences for d2fcba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb}
appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls

SCOP Domain Coordinates for d2fcba1:

Click to download the PDB-style file with coordinates for d2fcba1.
(The format of our PDB-style files is described here.)

Timeline for d2fcba1:

Domains from same chain:
(mouse over for more information)
d2fcba2