![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (22 proteins) |
![]() | Protein NT3 binding domain of trkC receptor [49194] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49195] (1 PDB entry) |
![]() | Domain d1wwca_: 1wwc A: [21778] |
PDB Entry: 1wwc (more details), 1.9 Å
SCOP Domain Sequences for d1wwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens)} tvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqegeis egcllfnkpthynngnytliaknplgtanqtinghflkepfpvde
Timeline for d1wwca_: