Lineage for d1wwca_ (1wwc A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54464Protein NT3 binding domain of trkC receptor [49194] (1 species)
  7. 54465Species Human (Homo sapiens) [TaxId:9606] [49195] (1 PDB entry)
  8. 54466Domain d1wwca_: 1wwc A: [21778]

Details for d1wwca_

PDB Entry: 1wwc (more details), 1.9 Å

PDB Description: nt3 binding domain of human trkc receptor

SCOP Domain Sequences for d1wwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens)}
tvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqegeis
egcllfnkpthynngnytliaknplgtanqtinghflkepfpvde

SCOP Domain Coordinates for d1wwca_:

Click to download the PDB-style file with coordinates for d1wwca_.
(The format of our PDB-style files is described here.)

Timeline for d1wwca_: