Lineage for d1wwbx_ (1wwb X:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54420Protein Ligand binding domain of trkB receptor [49192] (1 species)
  7. 54421Species Human (Homo sapiens) [TaxId:9606] [49193] (1 PDB entry)
  8. 54422Domain d1wwbx_: 1wwb X: [21777]

Details for d1wwbx_

PDB Entry: 1wwb (more details), 2.1 Å

PDB Description: ligand binding domain of human trkb receptor

SCOP Domain Sequences for d1wwbx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens)}
vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpgid

SCOP Domain Coordinates for d1wwbx_:

Click to download the PDB-style file with coordinates for d1wwbx_.
(The format of our PDB-style files is described here.)

Timeline for d1wwbx_: