Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [226469] (2 PDB entries) |
Domain d3vc3d_: 3vc3 D: [217759] automated match to d1oasa_ complexed with c6p; mutant |
PDB Entry: 3vc3 (more details), 1.77 Å
SCOPe Domain Sequences for d3vc3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vc3d_ c.79.1.0 (D:) automated matches {Soybean (Glycine max) [TaxId: 3847]} astnikkhvsqligrtplvylnkvtegcgayvavkqemmqptasiadrpayamitdaeek nlitpgkttlieptsgnmgismafmaamkgykmvltmpsytslerrvtmrafgaeliltd pakgmggtvkkayellentpnahmlqqfsnpantqvhfettgpeiwedtngqvdifvmgi gsggtvsgvgqylksknpnvkiygvepsesnvlnggkpgphhitgngvgfkpdildldvm ekvlevssedavnmarvlalkeglmvgissgantvaalrlaqlpenkgklivtvhpsfge rylssvlfqelrqeaenmqpvav
Timeline for d3vc3d_: