SCOPe 2.03: Domain d3vbqa_: 3vbq A:

Lineage for d3vbqa_ (3vbq A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (59 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d3vbqa_: 3vbq A: [217750]
   automated match to d3r04a_
   complexed with 0f5

Details for d3vbqa_

PDB Entry: 3vbq, 1.85 Å

PDB Description: exploitation of hydrogen bonding constraints and flat hydrophobic energy landscapes in pim-1 kinase needle screening and inhibitor design

PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d3vbqa_:

Sequence; same for both SEQRES and ATOM records:

>d3vbqa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
esqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllk
kvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvlea
vrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewir
yhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalr
psdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d3vbqa_:

• d3vbqa_ is new in SCOPe 2.03-stable
  
• d3vbqa_ appears in SCOPe 2.04
  
• d3vbqa_ appears in the current release, SCOPe 2.08