Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species) OPK group(?); PIM subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [118134] (59 PDB entries) Uniprot P11309 33-305 ! Uniprot P11309 32-308 |
Domain d3vbqa_: 3vbq A: [217750] automated match to d3r04a_ complexed with 0f5 |
PDB Entry: 3vbq (more details), 1.85 Å
SCOPe Domain Sequences for d3vbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vbqa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} esqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllk kvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvlea vrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewir yhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalr psdrptfeeiqnhpwmqdvllpqetaeihlh
Timeline for d3vbqa_: