Lineage for d1wwwy_ (1www Y:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9531Protein NGF binding domain of trkA receptor [49190] (1 species)
  7. 9532Species Human (Homo sapiens) [TaxId:9606] [49191] (2 PDB entries)
  8. 9534Domain d1wwwy_: 1www Y: [21774]
    Other proteins in same PDB: d1wwwv_, d1wwww_

Details for d1wwwy_

PDB Entry: 1www (more details), 2.2 Å

PDB Description: ngf in complex with domain 5 of the trka receptor

SCOP Domain Sequences for d1wwwy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwwy_ b.1.1.4 (Y:) NGF binding domain of trkA receptor {Human (Homo sapiens)}
vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp

SCOP Domain Coordinates for d1wwwy_:

Click to download the PDB-style file with coordinates for d1wwwy_.
(The format of our PDB-style files is described here.)

Timeline for d1wwwy_: