SCOPe 2.08: Domain d3vaya_: 3vay A:

Lineage for d3vaya_ (3vay A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:223283] [226550] (1 PDB entry)

8. Domain d3vaya_: 3vay A: [217734]
   automated match to d3qnma_
   complexed with iod, mg

Details for d3vaya_

PDB Entry: 3vay, 1.98 Å

PDB Description: crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000

PDB Compounds: (A:) HAD-superfamily hydrolase

SCOPe Domain Sequences for d3vaya_:

Sequence; same for both SEQRES and ATOM records:

>d3vaya_ c.108.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 223283]}
miklvtfdlddtlwdtapaivgaeaalrdwlaeqapklgpvpvehlweirsrlldedpsf
khrisalrrrvlfhaledagydsdeaqqladesfevflhgrhqvqifpevqptleilakt
ftlgvitngnadvrrlgladyfafalcaedlgigkpdpapflealrrakvdasaavhvgd
hpsddiagaqqagmraiwynpqgkawdadrlpdaeihnlsqlpevlarwa

Timeline for d3vaya_:

• d3vaya_ first appeared in SCOPe 2.03
  
• d3vaya_ appears in SCOPe 2.07