SCOPe 2.05: Domain d3v95b2: 3v95 B:342-445

Lineage for d3v95b2 (3v95 B:342-445)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (49 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d3v95b2: 3v95 B:342-445 [217724]
   Other proteins in same PDB: d3v95a1, d3v95b1
   automated match to d1oqxa2
   complexed with gol

Details for d3v95b2

PDB Entry: 3v95, 2.7 Å

PDB Description: crystal structure of monoclonal human anti-rhesus d fc and igg1 t125(yb2/0) in the presence of edta

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3v95b2:

Sequence; same for both SEQRES and ATOM records:

>d3v95b2 b.1.1.2 (B:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

Timeline for d3v95b2:

• d3v95b2 first appeared in SCOPe 2.03
  
• d3v95b2 appears in SCOPe 2.04
  
• d3v95b2 appears in SCOPe 2.06
  
• d3v95b2 appears in the current release, SCOPe 2.08