Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [226313] (2 PDB entries) |
Domain d3v93f_: 3v93 F: [217710] automated match to d2chma1 complexed with mg, zn |
PDB Entry: 3v93 (more details), 2 Å
SCOPe Domain Sequences for d3v93f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v93f_ a.211.1.0 (F:) automated matches {Trypanosoma cruzi [TaxId: 5693]} trrlppsivqdtilavvppkscaaigtdvdlrdwgfdtfevasrvpsvlqsvamhvalaw dffasqeeaqkwaflvaavennyrpnpyhnaihaadvlqgtfslvsaakplmehltplec kaaafaalthdvchpgrtnaflaavqdpvsfkfsgkgtleqlhtatafellnvtefdfts smdnasflefknivshlightdmslhsetvakhgaklsaggfdctckedrlealslllha adigassrgvaiarkwlvilqefadqaederrrglpvtpgfetpssveksqipfldffvi ptfdllhqlfpsieeplhnlrklrelyaakagvt
Timeline for d3v93f_: