Lineage for d1qsva_ (1qsv A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54467Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 54468Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries)
  8. 54475Domain d1qsva_: 1qsv A: [21771]

Details for d1qsva_

PDB Entry: 1qsv (more details)

PDB Description: the vegf-binding domain of flt-1, 20 nmr structures

SCOP Domain Sequences for d1qsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsva_ b.1.1.4 (A:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
rkgfiisnatykeiglltceatvnghlyktnylthrqtnti

SCOP Domain Coordinates for d1qsva_:

Click to download the PDB-style file with coordinates for d1qsva_.
(The format of our PDB-style files is described here.)

Timeline for d1qsva_: