![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (21 proteins) |
![]() | Protein Second domain of the Flt-1 receptor [49188] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries) |
![]() | Domain d1qsva_: 1qsv A: [21771] |
PDB Entry: 1qsv (more details)
SCOP Domain Sequences for d1qsva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsva_ b.1.1.4 (A:) Second domain of the Flt-1 receptor {Human (Homo sapiens)} sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds rkgfiisnatykeiglltceatvnghlyktnylthrqtnti
Timeline for d1qsva_: