Lineage for d3v93b_ (3v93 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737565Species Trypanosoma cruzi [TaxId:5693] [226313] (2 PDB entries)
  8. 2737567Domain d3v93b_: 3v93 B: [217706]
    automated match to d2chma1
    complexed with mg, zn

Details for d3v93b_

PDB Entry: 3v93 (more details), 2 Å

PDB Description: unliganded structure of TcrPDEC1 catalytic domain
PDB Compounds: (B:) Cyclic nucleotide specific phosphodiesterase

SCOPe Domain Sequences for d3v93b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v93b_ a.211.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
trrlppsivqdtilavvppkscaaigtdvdlrdwgfdtfevasrvpsvlqsvamhvalaw
dffasqeeaqkwaflvaavennyrpnpyhnaihaadvlqgtfslvsaakplmehltplec
kaaafaalthdvchpgrtnaflaavqdpvsfkfsgkgtleqlhtatafellnvtefdfts
smdnasflefknivshlightdmslhsetvakhgaklsaggfdctckedrlealslllha
adigassrgvaiarkwlvilqefadqaederrrglpvtpgfetpssveksqipfldffvi
ptfdllhqlfpsieeplhnlrklrelyaakagv

SCOPe Domain Coordinates for d3v93b_:

Click to download the PDB-style file with coordinates for d3v93b_.
(The format of our PDB-style files is described here.)

Timeline for d3v93b_: