Lineage for d3v8ta_ (3v8t A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435504Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1435505Species Human (Homo sapiens) [TaxId:9606] [111195] (26 PDB entries)
    Uniprot Q08881 357-619
  8. 1435525Domain d3v8ta_: 3v8t A: [217703]
    automated match to d3v8wb_
    complexed with 477, so4

Details for d3v8ta_

PDB Entry: 3v8t (more details), 2 Å

PDB Description: crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 477
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3v8ta_:

Sequence, based on SEQRES records: (download)

>d3v8ta_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaes

Sequence, based on observed residues (ATOM records): (download)

>d3v8ta_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
vihrdlaarnclvgenqvikvsdfgmpvkwaspevfsfsryssksdvwsfgvlmwevfse
gkipyevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaes

SCOPe Domain Coordinates for d3v8ta_:

Click to download the PDB-style file with coordinates for d3v8ta_.
(The format of our PDB-style files is described here.)

Timeline for d3v8ta_: