SCOP 1.63: Domain d1qtyu_: 1qty U:

Lineage for d1qtyu_ (1qty U:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (27 proteins)

6. Protein Second domain of the Flt-1 receptor [49188] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries)

8. Domain d1qtyu_: 1qty U: [21770]
   Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_
   complex with VEGF

Details for d1qtyu_

PDB Entry: 1qty, 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1qtyu_:

Sequence; same for both SEQRES and ATOM records:

>d1qtyu_ b.1.1.4 (U:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

Timeline for d1qtyu_:

• d1qtyu_ first appeared (with stable ids) in SCOP 1.55
  
• d1qtyu_ appears in SCOP 1.61
  
• d1qtyu_ appears in SCOP 1.65
  
• d1qtyu_ appears in the current release, SCOPe 2.08