SCOPe 2.03: Domain d3v7ma1: 3v7m A:236-339

Lineage for d3v7ma1 (3v7m A:236-339)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3v7ma1: 3v7m A:236-339 [217692]
   automated match to d2ql1a1
   complexed with gol, imd, zn

Details for d3v7ma1

PDB Entry: 3v7m, 2.02 Å

PDB Description: crystal structure of monoclonal human anti-rhesus d fc igg1 t125(yb2/0) in the presence of zn2+

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3v7ma1:

Sequence; same for both SEQRES and ATOM records:

>d3v7ma1 b.1.1.2 (A:236-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d3v7ma1:

• d3v7ma1 is new in SCOPe 2.03-stable
  
• d3v7ma1 appears in SCOPe 2.04
  
• d3v7ma1 appears in the current release, SCOPe 2.08