Lineage for d3v6fb1 (3v6f B:1-114)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034823Domain d3v6fb1: 3v6f B:1-114 [217680]
    Other proteins in same PDB: d3v6fb2, d3v6fd2, d3v6ff2, d3v6fl2
    automated match to d2fatl1

Details for d3v6fb1

PDB Entry: 3v6f (more details), 2.52 Å

PDB Description: Crystal Structure of an anti-HBV e-antigen monoclonal Fab fragment (e6), unbound
PDB Compounds: (B:) Fab e6 Light Chain

SCOPe Domain Sequences for d3v6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v6fb1 b.1.1.0 (B:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nimmtqspsslavsagekvtmnckssqsvlyssnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqtedlavyychqylssymytfgggtkleik

SCOPe Domain Coordinates for d3v6fb1:

Click to download the PDB-style file with coordinates for d3v6fb1.
(The format of our PDB-style files is described here.)

Timeline for d3v6fb1: