Lineage for d1qtyy_ (1qty Y:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54467Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 54468Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries)
  8. 54474Domain d1qtyy_: 1qty Y: [21768]
    Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_

Details for d1qtyy_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1qtyy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtyy_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

SCOP Domain Coordinates for d1qtyy_:

Click to download the PDB-style file with coordinates for d1qtyy_.
(The format of our PDB-style files is described here.)

Timeline for d1qtyy_: