![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (25 proteins) |
![]() | Protein Second domain of the Flt-1 receptor [49188] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries) |
![]() | Domain d1qtyx_: 1qty X: [21767] Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_ |
PDB Entry: 1qty (more details), 2.7 Å
SCOP Domain Sequences for d1qtyx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtyx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens)} grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg fiisnatykeiglltceatvnghlyktnylthrq
Timeline for d1qtyx_: