SCOPe 2.03: Domain d3v57c_: 3v57 C:

Lineage for d3v57c_ (3v57 C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (8 species)
   not a true protein

7. Species Red alga (Porphyridium purpureum) [TaxId:35688] [194584] (2 PDB entries)

8. Domain d3v57c_: 3v57 C: [217669]
   automated match to d3v58c_
   complexed with peb, so4

Details for d3v57c_

PDB Entry: 3v57, 1.7 Å

PDB Description: Crystal Structure of the B-phycoerythrin from the red algae Porphyridium Cruentum at pH8

PDB Compounds: (C:) Phycoerythrin alpha subunit

SCOPe Domain Sequences for d3v57c_:

Sequence; same for both SEQRES and ATOM records:

>d3v57c_ a.1.1.3 (C:) automated matches {Red alga (Porphyridium purpureum) [TaxId: 35688]}
mksvittvvsaadaagrfpsnsdlesiqgniqrsaarleaaeklagnheavvkeagdacf
akyaylknpgeagenqekinkcyrdvdhymrlvnyclvvggtgpldewgiagarevyrtl
nlptsayvasiaytrdrlcvprdmsaqagvefsayldylinals

Timeline for d3v57c_:

• d3v57c_ is new in SCOPe 2.03-stable
  
• d3v57c_ appears in SCOPe 2.04
  
• d3v57c_ appears in the current release, SCOPe 2.08