Lineage for d3v4za2 (3v4z A:97-306)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433300Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1433301Protein automated matches [226904] (18 species)
    not a true protein
  7. 1433384Species Yersinia pestis [TaxId:214092] [226277] (1 PDB entry)
  8. 1433385Domain d3v4za2: 3v4z A:97-306 [217664]
    Other proteins in same PDB: d3v4za1, d3v4zb1
    automated match to d1iova2
    complexed with peg, pge

Details for d3v4za2

PDB Entry: 3v4z (more details), 2.69 Å

PDB Description: d-alanine--d-alanine ligase from yersinia pestis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3v4za2:

Sequence, based on SEQRES records: (download)

>d3v4za2 d.142.1.0 (A:97-306) automated matches {Yersinia pestis [TaxId: 214092]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

Sequence, based on observed residues (ATOM records): (download)

>d3v4za2 d.142.1.0 (A:97-306) automated matches {Yersinia pestis [TaxId: 214092]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgktqyfcpsg
lsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaar
qyglsfsqlvarilmlad

SCOPe Domain Coordinates for d3v4za2:

Click to download the PDB-style file with coordinates for d3v4za2.
(The format of our PDB-style files is described here.)

Timeline for d3v4za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v4za1