Lineage for d1flty_ (1flt Y:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9540Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 9541Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries)
  8. 9543Domain d1flty_: 1flt Y: [21766]
    Other proteins in same PDB: d1fltv_, d1fltw_

Details for d1flty_

PDB Entry: 1flt (more details), 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1flty_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flty_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

SCOP Domain Coordinates for d1flty_:

Click to download the PDB-style file with coordinates for d1flty_.
(The format of our PDB-style files is described here.)

Timeline for d1flty_: