Lineage for d1fltx_ (1flt X:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787368Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 787369Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)
  8. 787370Domain d1fltx_: 1flt X: [21765]
    Other proteins in same PDB: d1fltv_, d1fltw_

Details for d1fltx_

PDB Entry: 1flt (more details), 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor
PDB Compounds: (X:) fms-like tyrosine kinase 1

SCOP Domain Sequences for d1fltx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrqt

SCOP Domain Coordinates for d1fltx_:

Click to download the PDB-style file with coordinates for d1fltx_.
(The format of our PDB-style files is described here.)

Timeline for d1fltx_: