SCOPe 2.04: Domain d3v4nd1: 3v4n D:1-167

Lineage for d3v4nd1 (3v4n D:1-167)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species)
   most similar to FabH

7. Species Enterococcus faecalis [TaxId:1351] [225034] (4 PDB entries)

8. Domain d3v4nd1: 3v4n D:1-167 [217645]
   automated match to d1tvza1
   complexed with btb

Details for d3v4nd1

PDB Entry: 3v4n, 1.6 Å

PDB Description: The Biochemical and Structural Basis for Inhibition of Enterococcus faecalis HMG-CoA Synthatse, mvaS, by Hymeglusin

PDB Compounds: (D:) HMG-CoA synthase

SCOPe Domain Sequences for d3v4nd1:

Sequence; same for both SEQRES and ATOM records:

>d3v4nd1 c.95.1.2 (D:1-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Enterococcus faecalis [TaxId: 1351]}
mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvssepr

Timeline for d3v4nd1:

• d3v4nd1 first appeared in SCOPe 2.03
  
• d3v4nd1 appears in SCOPe 2.05
  
• d3v4nd1 appears in the current release, SCOPe 2.08