Lineage for d1cs6a1 (1cs6 A:7-103)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104726Protein Axonin-1 [49184] (1 species)
  7. 104727Species Ckicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry)
  8. 104728Domain d1cs6a1: 1cs6 A:7-103 [21760]

Details for d1cs6a1

PDB Entry: 1cs6 (more details), 1.8 Å

PDB Description: n-terminal fragment of axonin-1 from chicken

SCOP Domain Sequences for d1cs6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Ckicken (Gallus gallus)}
rsygpvfeeqpahtlfpegsaeekvtltcraranppatyrwkmngtelkmgpdsryrlva
gdlvisnpvkakdagsyqcvatnargtvvsreaslrf

SCOP Domain Coordinates for d1cs6a1:

Click to download the PDB-style file with coordinates for d1cs6a1.
(The format of our PDB-style files is described here.)

Timeline for d1cs6a1: