Lineage for d3v0wl2 (3v0w L:108-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030605Domain d3v0wl2: 3v0w L:108-211 [217593]
    Other proteins in same PDB: d3v0wl1
    automated match to d2aabl2
    complexed with gm0, gmh, so4

Details for d3v0wl2

PDB Entry: 3v0w (more details), 1.73 Å

PDB Description: crystal structure of fab wn1 222-5 in complex with lps
PDB Compounds: (L:) WN1 222-5 Fab (IgG2a) light chain

SCOPe Domain Sequences for d3v0wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0wl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3v0wl2:

Click to download the PDB-style file with coordinates for d3v0wl2.
(The format of our PDB-style files is described here.)

Timeline for d3v0wl2: