Lineage for d3v0vl2 (3v0v L:108-212)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1295044Domain d3v0vl2: 3v0v L:108-212 [217591]
    Other proteins in same PDB: d3v0vb1, d3v0vl1
    automated match to d2aabl2

Details for d3v0vl2

PDB Entry: 3v0v (more details), 2.13 Å

PDB Description: fab wn1 222-5 unliganded
PDB Compounds: (L:) WN1 222-5 Fab (IgG2a) light chain

SCOPe Domain Sequences for d3v0vl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0vl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrg

SCOPe Domain Coordinates for d3v0vl2:

Click to download the PDB-style file with coordinates for d3v0vl2.
(The format of our PDB-style files is described here.)

Timeline for d3v0vl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v0vl1