SCOP 1.55: Domain d1bihb4: 1bih B:307-395

Lineage for d1bihb4 (1bih B:307-395)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein Hemolin [49182] (1 species)

7. Species Moth (Hyalophora cecropia) [TaxId:7123] [49183] (1 PDB entry)

8. Domain d1bihb4: 1bih B:307-395 [21759]

Details for d1bihb4

PDB Entry: 1bih, 3.1 Å

PDB Description: crystal structure of the insect immune protein hemolin: a new domain arrangement with implications for homophilic adhesion

SCOP Domain Sequences for d1bihb4:

Sequence; same for both SEQRES and ATOM records:

>d1bihb4 b.1.1.4 (B:307-395) Hemolin {Moth (Hyalophora cecropia)}
sapkyeqkpekvivvkqgqdvtipckvtglpapnvvwshnakplsggratvtdsglvikg
vkngdkgyygcratnehgdkyfetlvqvn

Timeline for d1bihb4:

• d1bihb4 appears in SCOP 1.57
  
• d1bihb4 appears in the current release, SCOPe 2.08