Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (4 PDB entries) |
Domain d3v0ac_: 3v0a C: [217584] automated match to d1mqkh_ complexed with ca, mes, so4, zn |
PDB Entry: 3v0a (more details), 2.7 Å
SCOPe Domain Sequences for d3v0ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v0ac_ b.1.1.0 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} sqvqlvesggglvqpggslrlscaasgftlgsrymswvrqapgegfewvssiepsgtawd gdsakgrfttsrddakntlylqmsnlqpedtgvyycatgyrtdtripggswgqgtqvtv
Timeline for d3v0ac_: