SCOPe 2.03: Domain d3uxna2: 3uxn A:92-148

Lineage for d3uxna2 (3uxn A:92-148)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (20 PDB entries)

8. Domain d3uxna2: 3uxn A:92-148 [217565]
   Other proteins in same PDB: d3uxna1, d3uxna3, d3uxnb1, d3uxnb3
   automated match to d1huza3

Details for d3uxna2

PDB Entry: 3uxn, 2.5 Å

PDB Description: Crystal Structure of Rat DNA Polymerase Beta, Wild Type Apoenzyme

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3uxna2:

Sequence; same for both SEQRES and ATOM records:

>d3uxna2 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d3uxna2:

• d3uxna2 is new in SCOPe 2.03-stable
  
• d3uxna2 appears in SCOPe 2.04
  
• d3uxna2 appears in the current release, SCOPe 2.08