Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
Protein DNA polymerase beta [81579] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (20 PDB entries) |
Domain d3uxna2: 3uxn A:92-148 [217565] Other proteins in same PDB: d3uxna1, d3uxna3, d3uxnb1, d3uxnb3 automated match to d1huza3 |
PDB Entry: 3uxn (more details), 2.5 Å
SCOPe Domain Sequences for d3uxna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uxna2 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek
Timeline for d3uxna2: