Lineage for d3uxmd_ (3uxm D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872758Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (13 PDB entries)
  8. 2872775Domain d3uxmd_: 3uxm D: [217563]
    automated match to d3hjnb_
    complexed with 0dn, mg

Details for d3uxmd_

PDB Entry: 3uxm (more details), 1.95 Å

PDB Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation
PDB Compounds: (D:) thymidylate kinase

SCOPe Domain Sequences for d3uxmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxmd_ c.37.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyq
vldaglplaevqagldrllpnll

SCOPe Domain Coordinates for d3uxmd_:

Click to download the PDB-style file with coordinates for d3uxmd_.
(The format of our PDB-style files is described here.)

Timeline for d3uxmd_: