Lineage for d3uxma_ (3uxm A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366515Species Pseudomonas aeruginosa [TaxId:208964] [226294] (2 PDB entries)
  8. 1366517Domain d3uxma_: 3uxm A: [217560]
    automated match to d3hjnb_
    complexed with 0dn, mg

Details for d3uxma_

PDB Entry: 3uxm (more details), 1.95 Å

PDB Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3uxma_:

Sequence, based on SEQRES records: (download)

>d3uxma_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyq
vldaglplaevqagldrllpnllerl

Sequence, based on observed residues (ATOM records): (download)

>d3uxma_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
glfvtlegpegtnrdylaerlrergievqltrepggtplaerirelllapsdepmaadte
lllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesfvqgd
lrpdltlvfdlpveiglarrldrfeqedrrffeavrqtylqraaqaperyqvldaglpla
evqagldrllpnllerl

SCOPe Domain Coordinates for d3uxma_:

Click to download the PDB-style file with coordinates for d3uxma_.
(The format of our PDB-style files is described here.)

Timeline for d3uxma_: