| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Hemolin [49182] (1 species) Duplication: tandem repeat of 4 domains, known as L1 domains |
| Species Moth (Hyalophora cecropia) [TaxId:7123] [49183] (1 PDB entry) |
| Domain d1bihb1: 1bih B:5-98 [21756] complexed with po4 |
PDB Entry: 1bih (more details), 3.1 Å
SCOPe Domain Sequences for d1bihb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bihb1 b.1.1.4 (B:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]}
kypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkdegsl
vflrpqasdeghyqcfaetpagvassrvisfrkt
Timeline for d1bihb1:
View in 3DDomains from other chains: (mouse over for more information) d1biha1, d1biha2, d1biha3, d1biha4 |