Lineage for d1bihb1 (1bih B:5-98)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54353Protein Hemolin [49182] (1 species)
  7. 54354Species Moth (Hyalophora cecropia) [TaxId:7123] [49183] (1 PDB entry)
  8. 54359Domain d1bihb1: 1bih B:5-98 [21756]

Details for d1bihb1

PDB Entry: 1bih (more details), 3.1 Å

PDB Description: crystal structure of the insect immune protein hemolin: a new domain arrangement with implications for homophilic adhesion

SCOP Domain Sequences for d1bihb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bihb1 b.1.1.4 (B:5-98) Hemolin {Moth (Hyalophora cecropia)}
kypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkdegsl
vflrpqasdeghyqcfaetpagvassrvisfrkt

SCOP Domain Coordinates for d1bihb1:

Click to download the PDB-style file with coordinates for d1bihb1.
(The format of our PDB-style files is described here.)

Timeline for d1bihb1: