SCOPe 2.04: Domain d3uw8a2: 3uw8 A:424-731

Lineage for d3uw8a2 (3uw8 A:424-731)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (9 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)

8. Domain d3uw8a2: 3uw8 A:424-731 [217546]
   Other proteins in same PDB: d3uw8b1, d3uw8b2
   automated match to d1ub2a2
   complexed with hem

Details for d3uw8a2

PDB Entry: 3uw8, 2.35 Å

PDB Description: Crystal Structure Analysis of the Ser305Thr Variants of KatG from Haloarcula marismortui

PDB Compounds: (A:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3uw8a2:

Sequence; same for both SEQRES and ATOM records:

>d3uw8a2 a.93.1.0 (A:424-731) automated matches {Haloarcula marismortui [TaxId: 272569]}
deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga
ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave
qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn
adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad
sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm
kldrfdle

Timeline for d3uw8a2:

• d3uw8a2 first appeared in SCOPe 2.03
  
• d3uw8a2 appears in SCOPe 2.05
  
• d3uw8a2 appears in the current release, SCOPe 2.08