SCOPe 2.05: Domain d3uv9a_: 3uv9 A:

Lineage for d3uv9a_ (3uv9 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226434] (2 PDB entries)

8. Domain d3uv9a_: 3uv9 A: [217530]
   automated match to d2vokb_

Details for d3uv9a_

PDB Entry: 3uv9, 1.55 Å

PDB Description: structure of the rhesus monkey trim5alpha deltav1 pryspry domain

PDB Compounds: (A:) Tripartite motif-containing protein 5

SCOPe Domain Sequences for d3uv9a_:

Sequence; same for both SEQRES and ATOM records:

>d3uv9a_ b.29.1.0 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
teltdarrywvdvtlatnnishaviaedkrqvssragtgvlgsqsitsgkhywevdvskk
sawilgvcagfqsdamynieqnenyqpkygywviglqegvkysvfqdgsshtpfapfivp
lsviicpdrvgvfvdyeactvsffnitnhgfliykfsqcsfskpvfpylnprkctvpmtl
csp

Timeline for d3uv9a_:

• d3uv9a_ first appeared in SCOPe 2.03
  
• d3uv9a_ appears in SCOPe 2.04
  
• d3uv9a_ is called d3uv9a1 in SCOPe 2.06
  
• d3uv9a_ appears in the current release, SCOPe 2.08, called d3uv9a1