Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226434] (2 PDB entries) |
Domain d3uv9a1: 3uv9 A:292-495 [217530] Other proteins in same PDB: d3uv9a2 automated match to d2vokb_ |
PDB Entry: 3uv9 (more details), 1.55 Å
SCOPe Domain Sequences for d3uv9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uv9a1 b.29.1.0 (A:292-495) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} eltdarrywvdvtlatnnishaviaedkrqvssragtgvlgsqsitsgkhywevdvskks awilgvcagfqsdamynieqnenyqpkygywviglqegvkysvfqdgsshtpfapfivpl sviicpdrvgvfvdyeactvsffnitnhgfliykfsqcsfskpvfpylnprkctvpmtlc sp
Timeline for d3uv9a1: