Lineage for d3uv9a1 (3uv9 A:292-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781253Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226434] (2 PDB entries)
  8. 2781254Domain d3uv9a1: 3uv9 A:292-495 [217530]
    Other proteins in same PDB: d3uv9a2
    automated match to d2vokb_

Details for d3uv9a1

PDB Entry: 3uv9 (more details), 1.55 Å

PDB Description: structure of the rhesus monkey trim5alpha deltav1 pryspry domain
PDB Compounds: (A:) Tripartite motif-containing protein 5

SCOPe Domain Sequences for d3uv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uv9a1 b.29.1.0 (A:292-495) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
eltdarrywvdvtlatnnishaviaedkrqvssragtgvlgsqsitsgkhywevdvskks
awilgvcagfqsdamynieqnenyqpkygywviglqegvkysvfqdgsshtpfapfivpl
sviicpdrvgvfvdyeactvsffnitnhgfliykfsqcsfskpvfpylnprkctvpmtlc
sp

SCOPe Domain Coordinates for d3uv9a1:

Click to download the PDB-style file with coordinates for d3uv9a1.
(The format of our PDB-style files is described here.)

Timeline for d3uv9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uv9a2