SCOP 1.59: Domain d1biha1: 1bih A:5-98

Lineage for d1biha1 (1bih A:5-98)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein Hemolin [49182] (1 species)

7. Species Moth (Hyalophora cecropia) [TaxId:7123] [49183] (1 PDB entry)

8. Domain d1biha1: 1bih A:5-98 [21752]

Details for d1biha1

PDB Entry: 1bih, 3.1 Å

PDB Description: crystal structure of the insect immune protein hemolin: a new domain arrangement with implications for homophilic adhesion

SCOP Domain Sequences for d1biha1:

Sequence; same for both SEQRES and ATOM records:

>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia)}
kypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkdegsl
vflrpqasdeghyqcfaetpagvassrvisfrkt

Timeline for d1biha1:

• d1biha1 first appeared (with stable ids) in SCOP 1.55
  
• d1biha1 appears in SCOP 1.57
  
• d1biha1 appears in SCOP 1.61
  
• d1biha1 appears in the current release, SCOPe 2.08