SCOPe 2.08: Domain d3us8a_: 3us8 A:

Lineage for d3us8a_ (3us8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [226269] (1 PDB entry)

8. Domain d3us8a_: 3us8 A: [217506]
   automated match to d4ja8b_
   complexed with so4

Details for d3us8a_

PDB Entry: 3us8, 2.25 Å

PDB Description: Crystal Structure of an isocitrate dehydrogenase from Sinorhizobium meliloti 1021

PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d3us8a_:

Sequence; same for both SEQRES and ATOM records:

>d3us8a_ c.77.1.1 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
akikvanpvveldgdemtriiwqfikdklihpyldldleyydlgvenrdatddqvtidaa
naikkhgvgvkcatitpdegrveefklkkmwkspngtirnilggvifrepiicknvprlv
pgwtkpiivgrhafgdqyratdfkfpgkgklsikfvgedgqtiehdvydapgagvalamy
nldesitefarasfnyglqrkvpvylstkntilkaydgrfkdifqkvfdeefaaqfkaek
lwyehrliddmvasalkwsggyvwacknydgdvqsdivaqgfgslglmtsvlmtpdgktv
eaeaahgtvtrhyrqhqkgeetstnsiasifawtrglahrakldgnaelakfsetlervc
vdtvesgfmtkdlalligpdqpwlsttgfldkidenlrkam

Timeline for d3us8a_:

• d3us8a_ first appeared in SCOPe 2.03
  
• d3us8a_ appears in SCOPe 2.07