SCOP 1.55: Domain d1e0ob1: 1e0o B:149-250

Lineage for d1e0ob1 (1e0o B:149-250)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (3 PDB entries)

8. Domain d1e0ob1: 1e0o B:149-250 [21748]
   Other proteins in same PDB: d1e0oa_, d1e0oc_

Details for d1e0ob1

PDB Entry: 1e0o, 2.8 Å

PDB Description: crystal structure of a ternary fgf1-fgfr2-heparin complex

SCOP Domain Sequences for d1e0ob1:

Sequence; same for both SEQRES and ATOM records:

>d1e0ob1 b.1.1.4 (B:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

Timeline for d1e0ob1:

• d1e0ob1 appears in SCOP 1.57
  
• d1e0ob1 appears in the current release, SCOPe 2.08