SCOPe 2.03: Domain d3upea_: 3upe A:

Lineage for d3upea_ (3upe A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d3upea_: 3upe A: [217471]
   automated match to d3uuza_
   complexed with 0ca, ca, gol, so4

Details for d3upea_

PDB Entry: 3upe, 1.54 Å

PDB Description: Bovine trypsin variant X(triplePhe227) in complex with small molecule inhibitor

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3upea_:

Sequence; same for both SEQRES and ATOM records:

>d3upea_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgsgcaqknkpgfytklcnyvswikqtiasn

Timeline for d3upea_:

• d3upea_ is new in SCOPe 2.03-stable
  
• d3upea_ appears in SCOPe 2.04
  
• d3upea_ appears in the current release, SCOPe 2.08