Lineage for d1djsa2 (1djs A:251-362)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9429Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 9443Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (3 PDB entries)
  8. 9453Domain d1djsa2: 1djs A:251-362 [21747]
    Other proteins in same PDB: d1djsb_

Details for d1djsa2

PDB Entry: 1djs (more details), 2.4 Å

PDB Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1

SCOP Domain Sequences for d1djsa2:

Sequence, based on SEQRES records: (download)

>d1djsa2 b.1.1.4 (A:251-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpa

Sequence, based on observed residues (ATOM records): (download)

>d1djsa2 b.1.1.4 (A:251-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekpylkvlkaagvntt
dkeievlyirnvtfedageytclagnsigisfhsawltvlpa

SCOP Domain Coordinates for d1djsa2:

Click to download the PDB-style file with coordinates for d1djsa2.
(The format of our PDB-style files is described here.)

Timeline for d1djsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1djsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1djsb_