Lineage for d3un1c_ (3un1 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351082Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)
  8. 1351085Domain d3un1c_: 3un1 C: [217457]
    automated match to d2c07a1
    complexed with po4

Details for d3un1c_

PDB Entry: 3un1 (more details), 2.45 Å

PDB Description: Crystal structure of an oxidoreductase from Sinorhizobium meliloti 1021
PDB Compounds: (C:) Probable oxidoreductase

SCOPe Domain Sequences for d3un1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3un1c_ c.2.1.0 (C:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
qqkvvvitgasqgigaglvrayrdrnyrvvatsrsikpsadpdihtvagdiskpetadri
vregierfgridslvnnagvflakpfvemtqedydhnlgvnvagffhitqraaaemlkqg
sghivsittslvdqpmvgmpsalasltkgglnavtrslamefsrsgvrvnavspgviktp
mhpaethstlaglhpvgrmgeirdvvdavlylehagfitgeilhvdggqnagrw

SCOPe Domain Coordinates for d3un1c_:

Click to download the PDB-style file with coordinates for d3un1c_.
(The format of our PDB-style files is described here.)

Timeline for d3un1c_: