SCOPe 2.03: Domain d3umwa_: 3umw A:

Lineage for d3umwa_ (3umw A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (59 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d3umwa_: 3umw A: [217453]
   automated match to d3jy0a_
   complexed with 596, gol, so4

Details for d3umwa_

PDB Entry: 3umw, 2.08 Å

PDB Description: Crystal structure of Pim1 kinase in complex with inhibitor (Z)-2-[(1H-indazol-3-yl)methylene]-6-methoxy-7-(piperazin-1-ylmethyl)benzofuran-3(2H)-one

PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d3umwa_:

Sequence, based on SEQRES records:

>d3umwa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
qyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkv
ssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavr
hchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryh
ryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrps
drptfeeiqnhpwmqdvllpqetaeihl

Sequence, based on observed residues (ATOM records):

>d3umwa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
qyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelrvpmevvllkkvssgf
sgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchn
cgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhg
rsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrpt
feeiqnhpwmqdvllpqetaeihl

Timeline for d3umwa_:

• d3umwa_ is new in SCOPe 2.03-stable
  
• d3umwa_ appears in SCOPe 2.04
  
• d3umwa_ appears in the current release, SCOPe 2.08