Lineage for d3ujtl2 (3ujt L:108-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763735Domain d3ujtl2: 3ujt L:108-211 [217438]
    Other proteins in same PDB: d3ujtl1, d3ujtm1
    automated match to d2fd6l2
    complexed with gol, trs

Details for d3ujtl2

PDB Entry: 3ujt (more details), 2.1 Å

PDB Description: Structure of the Fab fragment of Ab-52, an antibody that binds the O-antigen of Francisella tularensis
PDB Compounds: (L:) Ab-52 light chain

SCOPe Domain Sequences for d3ujtl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujtl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3ujtl2:

Click to download the PDB-style file with coordinates for d3ujtl2.
(The format of our PDB-style files is described here.)

Timeline for d3ujtl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ujtl1