Lineage for d3ujpa_ (3ujp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912891Species Synechocystis sp. [TaxId:1148] [226531] (1 PDB entry)
  8. 2912892Domain d3ujpa_: 3ujp A: [217426]
    automated match to d1psza_
    complexed with cac, mn, zn

Details for d3ujpa_

PDB Entry: 3ujp (more details), 2.7 Å

PDB Description: Structure of MntC protein at 2.7A
PDB Compounds: (A:) Mn transporter subunit

SCOPe Domain Sequences for d3ujpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujpa_ c.92.2.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
teekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyn
gmnlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenir
qafveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardy
gmeeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfgg
nlyvdslsteegpvptfldlleydarvitnglla

SCOPe Domain Coordinates for d3ujpa_:

Click to download the PDB-style file with coordinates for d3ujpa_.
(The format of our PDB-style files is described here.)

Timeline for d3ujpa_: