Lineage for d1ev2g1 (1ev2 G:151-250)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9429Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 9443Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (3 PDB entries)
  8. 9448Domain d1ev2g1: 1ev2 G:151-250 [21742]
    Other proteins in same PDB: d1ev2a_, d1ev2b_, d1ev2c_, d1ev2d_

Details for d1ev2g1

PDB Entry: 1ev2 (more details), 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)

SCOP Domain Sequences for d1ev2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev2g1 b.1.1.4 (G:151-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOP Domain Coordinates for d1ev2g1:

Click to download the PDB-style file with coordinates for d1ev2g1.
(The format of our PDB-style files is described here.)

Timeline for d1ev2g1: