Lineage for d3uj2b1 (3uj2 B:2-139)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191599Species Anaerostipes caccae [TaxId:411490] [226255] (1 PDB entry)
  8. 2191601Domain d3uj2b1: 3uj2 B:2-139 [217404]
    Other proteins in same PDB: d3uj2a2, d3uj2b2, d3uj2c2, d3uj2d2, d3uj2e2, d3uj2f2, d3uj2g2, d3uj2h2
    automated match to d1iyxa2
    complexed with mg, so4

Details for d3uj2b1

PDB Entry: 3uj2 (more details), 2 Å

PDB Description: crystal structure of an enolase from anaerostipes caccae (efi target efi-502054) with bound mg and sulfate
PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d3uj2b1:

Sequence, based on SEQRES records: (download)

>d3uj2b1 d.54.1.0 (B:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]}
nyleiekvigreiidsrgnptveaevylaggvtgrgtapsgastgefealelrdgdkgrf
ggkgvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiaca
kaaaaalgvplyrflggl

Sequence, based on observed residues (ATOM records): (download)

>d3uj2b1 d.54.1.0 (B:2-139) automated matches {Anaerostipes caccae [TaxId: 411490]}
nyleiekvigreiidsrgnptveaevylaggvtgrgtapsggefealelrdgdkgrfggk
gvtkavqninteiseilsgmdasdiyavdramidadgtkdkskfganavlavsiacakaa
aaalgvplyrflggl

SCOPe Domain Coordinates for d3uj2b1:

Click to download the PDB-style file with coordinates for d3uj2b1.
(The format of our PDB-style files is described here.)

Timeline for d3uj2b1: