SCOPe 2.08: Domain d3ufxh2: 3ufx H:122-288

Lineage for d3ufxh2 (3ufx H:122-288)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.0: automated matches [227303] (1 protein)
   not a true family

6. Protein automated matches [227129] (4 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [226811] (1 PDB entry)

8. Domain d3ufxh2: 3ufx H:122-288 [217359]
   Other proteins in same PDB: d3ufxa1, d3ufxd1, d3ufxf1, d3ufxh1
   automated match to d2scua2
   complexed with gdp, mn

Details for d3ufxh2

PDB Entry: 3ufx, 2.35 Å

PDB Description: thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+

PDB Compounds: (H:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d3ufxh2:

Sequence; same for both SEQRES and ATOM records:

>d3ufxh2 c.23.4.0 (H:122-288) automated matches {Thermus aquaticus [TaxId: 271]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg
krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg

Timeline for d3ufxh2:

• d3ufxh2 first appeared in SCOPe 2.03
  
• d3ufxh2 appears in SCOPe 2.07